Everything below concerns Neurotrophic signalling. We keep the language plain, cite what the science says, and separate well-supported claims from open questions.
Updated 2026-07-19. Numbers and descriptions here follow the published literature rather than marketing material.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. Its chain combines the first seven residues of corticotropin with a C-terminal proline-glycine-proline extension, a modification intended to slow enzymatic breakdown. The free peptide has a molecular mass near 813.9 daltons. It belongs to the class of ACTH-derived fragments studied for central nervous system activity rather than for adrenal steroid stimulation. This structural relationship to a natural hormone fragment is the usual starting point for describing the compound in the literature.
Development took place during the 1980s at institutes of the Russian Academy of Sciences, where peptide fragments of ACTH were screened for cognitive and neuroprotective effects. The compound received regulatory approval in Russia as a nasal preparation, marketed for conditions such as ischemic stroke, transient ischemic attacks, and optic nerve disorders. Registration in other countries has not followed. Most published clinical reports originate from a small number of Russian research groups, and independent replication outside that setting remains limited. The regulatory status therefore differs sharply between Russia and the rest of the world.
Published research covers ischemic stroke, traumatic brain injury, cognitive impairment, optic nerve conditions and attention-related measures. Much of the human evidence comes from small trials conducted in one country, which limits how far the results generalize. Animal models supply the larger share of the data, and effects seen in rodents do not transfer automatically to people. Reviews have noted that methodological reporting is often incomplete, making it difficult to pool results or compare treatment schedules across studies.
Pharmacokinetic accounts emphasize rapid breakdown. After intravenous dosing the intact peptide disappears from blood within minutes, and nasal delivery produces low but measurable concentrations. Metabolites rather than the parent molecule may account for part of the observed activity, although the relative contribution is unresolved. Dosing in the literature varies widely and no optimal schedule has been agreed. These gaps are regularly cited as a reason the findings have not produced broad clinical adoption beyond the original research setting.
Proposed mechanisms center on neurotrophic signaling rather than on classical melanocortin receptor activation. Rodent experiments have reported shifts in the expression of brain-derived neurotrophic factor and nerve growth factor after administration, together with changes in the associated receptor systems. Several authors argue that the peptide acts largely through its degradation products and their interaction with peptidergic pathways, but this remains a hypothesis rather than a settled finding. No single molecular target has been identified in a way that the field broadly accepts.
| Property | Value | Notes |
|---|---|---|
| Sequence | Met-Glu-His-Phe-Pro-Gly-Pro | Heptapeptide; ACTH(4-10) analog extended at C-terminus |
| Molecular mass | ~813.9 Da | Free peptide, unmodified |
| Appearance | White to off-white powder | Typical lyophilized solid |
| Solubility | Soluble in water and saline | Also soluble in common aqueous buffers |
| Storage (solid) | -20 °C, desiccated | Protect from moisture and repeated thawing |
Later generations of the molecule include an N-acetylated form and an amidated form, both marketed online alongside the parent peptide. These variants differ in terminal chemistry and stability, and they are frequently discussed in the same breath even though they have not been compared in controlled trials. Supply outside formal healthcare systems comes largely from laboratories that synthesize peptides to order. Purity and identity of these materials vary widely, and no single body oversees the international trade.
Semax is a synthetic heptapeptide developed in the Soviet Union during the 1980s by researchers at the Institute of Molecular Genetics in Moscow. It was designed as a truncated analog of adrenocorticotropic hormone, retaining only the fragment spanning residues four through ten. Investigators sought a peptide that would preserve the cognitive effects associated with ACTH while eliminating the hormonal stimulation of the adrenal cortex. The compound entered clinical use in Russia during the following decade.
Solid semax is typically supplied as a lyophilised powder that is hygroscopic and sensitive to moisture, light, and repeated temperature cycling. Long-term storage of the dry peptide is generally recommended at approximately -20 degrees Celsius, while shorter working periods may use refrigeration at 2 to 8 degrees Celsius. Vials should remain tightly closed and desiccated when brought to room temperature, because condensation can damage the material before it is weighed. Dividing a batch into aliquots is preferable to thawing one container repeatedly.
Dissolution is normally performed in water, phosphate-buffered saline, or normal saline, since the peptide is freely soluble in aqueous media and is rarely handled with strong organic solvents. Solution pH should be kept near neutral, because extreme acidity or alkalinity accelerates backbone hydrolysis and encourages oxidation of the methionine side chain. Once dissolved, the material is less stable than the dry powder and is commonly divided into single-use portions and frozen. Buffers containing primary amines, such as Tris, are often avoided because of possible side reactions.
Scientific literature on semax is unevenly distributed. A substantial share of published work originates from a small number of laboratories in Russia, while independent replication elsewhere is limited. Human data consist mostly of small trials with short follow-up, and several reported outcomes rely on subjective rating scales. Questions about how much intact peptide reaches the central nervous system after nasal administration, and how long it persists there, are still unresolved. The compound is best described as an active research subject rather than a settled pharmacological agent.
Semax is a synthetic heptapeptide with the sequence Met-Glu-His-Phe-Pro-Gly-Pro. It was derived from the ACTH(4-10) fragment, a short segment of adrenocorticotropic hormone that lacks the hormonal activity associated with the full-length peptide. Researchers at the Institute of Molecular Genetics in Moscow developed the compound during the 1980s. It has been registered as a pharmaceutical product in Russia and several neighbouring countries, where it is supplied as a nasal solution, and it is also sold internationally as a research chemical.
==== Tryptophan and 5-HTP ==== The amino acid tryptophan is converted into 5-hydroxytryptophan (5-HTP) which is subsequently converted into the neurotransmitter serotonin. Since serotonin deficiency has been recognized as a possible cause of depression, it has been suggested that consumption of tryptophan or 5-HTP may therefore improve depression symptoms by increasing the level of serotonin in the brain. 5-HTP and tryptophan are sold over the counter in North America, but requires a prescription in Europe. The use of 5-HTP instead of tryptophan bypasses the conversion of tryptophan into 5-HTP by the enzyme tryptophan hydroxylase, which is the rate-limiting step in the synthesis of serotonin, and 5-HTP easily crosses the blood–brain barrier unlike tryptophan, which requires a transporter. Small studies have been performed using 5-HTP and tryptophan as adjunctive therapy in addition to standard treatment for depression. While some studies had positive results, they were criticized for having methodological flaws, and a more recent study did not find sustained benefit from their use. The safety of these medications has not been well studied. Due to the lack of high quality studies, preliminary nature of studies showing effectiveness, the lack of adequate study on their safety, and reports of eosinophilia–myalgia syndrome from contaminated tryptophan in 1989 and 1990, the use of tryptophan and 5-HTP is not highly recommended or thought to be clinically useful.
Several of the Union Republics themselves, most notably Russia, were further subdivided into Autonomous Soviet Socialist Republics (ASSRs). Though administratively part of their respective Union Republics, ASSRs were also established based on ethnic/cultural lines. On April 3, 1990, a law was passed which stated that when a union republic was voting to leave the Soviet Union, autonomous republics, autonomous oblasts, and autonomous okrugs had the right, by means of a referendum, to independently resolve whether they would stay in the USSR or leave with the seceding union republic, as well as broader rights to raise the issue of their state-legal status.
== Uses == Salts have long had a wide variety of uses and applications. Many minerals are ionic. Humans have processed common salt (sodium chloride) for over 8000 years, using it first as a food seasoning and preservative, and now also in manufacturing, agriculture, water conditioning, for de-icing roads, and many other uses. Many salts are so widely used in society that they go by common names unrelated to their chemical identity. Examples of this include borax, calomel, milk of magnesia, muriatic acid, oil of vitriol, saltpeter, and slaked lime. Soluble salts can easily be dissolved to provide electrolyte solutions. This is a simple way to control the concentration and ionic strength. The concentration of solutes affects many colligative properties, including increasing the osmotic pressure, and causing freezing-point depression and boiling-point elevation. Because the solutes are charged ions they also increase the electrical conductivity of the solution. The increased ionic strength reduces the thickness of the electrical double layer around colloidal particles, and therefore the stability of emulsions and suspensions. The chemical identity of the ions added is also important in many uses. For example, fluoride containing compounds are dissolved to supply fluoride ions for water fluoridation. Solid salts have long been used as paint pigments, and are resistant to organic solvents, but are sensitive to acidity or basicity. Since 1801 pyrotechnicians have described and widely used metal-containing salts as sources of colour in fireworks.
Glucagon-like peptide-2 (GLP-2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD (see Proteinogenic amino acid) in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs (such as Teduglutide) may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy. GLP-2 has an antidepressant effect in a mouse model of depression when delivered via intracerebroventricular injection. However, a GLP-2 derivative (PAS-CPP-GLP-2) was shown to be efficiently delivered to the brain intranasally, with similar efficacy.
Sources: en.wikipedia.org
=== Condom use === One Australian study of 184 men looked at penis length and circumference in relation to condom breakage or slippage. 3,658 condoms were used. The study found that when used correctly, condoms had a breakage rate of 1.34% and a slippage rate of 2.05%, for a total failure rate of 3.39%. Penile dimensions did not influence slippage, although penis circumference and broken condoms were strongly correlated, with larger sizes increasing the rate of breakage.
== Bibliography == Allport, Alan (2015). Browned Off and Bloody-minded: The British Soldier Goes to War 1939–1945. New Haven: Yale University Press. ISBN 978-0-300-17075-7. Beckett, Ian F. W. Territorials: A Century of Service, first published April 2008 by DRA Printing of 14 Mary Seacole Road, The Millfields, Plymouth PL1 3JY on behalf of TA 100, ISBN 978-0-9557813-1-5 Bell, P. M. H. (1997) [1986]. The Origins of the Second World War in Europe (2nd ed.). London: Pearson. ISBN 978-0-582-30470-3. Campbell, John (2020). Haldane: The Forgotten Statesman Who Shaped Modern Britain. London: Hurst & Co. Dennis, Peter (1987). The Territorial Army. Woodbridge: The Royal Historical Society: Boydell Press.{{cite book}}: CS1 maint: publisher location (link) Dunlop, John K (1938). The development of the British Army 1899–1914. London: Methuen. Frederick, J. B. M. (1984). Lineage book of British land forces 1660-1978 : biographical outlines of cavalry, yeomanry, armour, artillery, infantry, marines and air force land troops of regular and reserve forces (Volume I). Wakefield: Microform Academic. ISBN 978-1-85117-007-4. OCLC 18072764. French, David (2001) [2000]. Raising Churchill's Army: The British Army and the War Against Germany 1919–1945. Oxford: Oxford University Press. ISBN 978-0-199-24630-4. Gibbs, N. H. (1976). Grand Strategy. History of the Second World War. Vol. I. London: HMSO. ISBN 978-0-116-30181-9. Gregory, Barry (2006). A History of the Artists Rifles 1859-1947. Barnsley: Pen and Sword. Heyman, M. A.
"Absorption spectrum of melanin". Department of Computer Science and Technology. "Tyrosine metabolism—Reference pathway". Kyoto Encyclopedia of Genes and Genomes. Retrieved 13 June 2024. "Melanogenesis". Kyoto Encyclopedia of Genes and Genomes. Retrieved 13 June 2024.
Following the UDI, however, Rhodesia began to demonstrate that it had the potential to develop a greater degree of economic self-sufficiency. After the Rhodesian Front began introducing incentives accorded to domestic production, industrial output expanded dramatically. A rigid system of countermeasures enacted to combat sanctions succeeded in blunting their impact for at least a decade. Over the next nine years, Rhodesian companies, spiting the freezing of their assets and blocking of overseas accounts, also perfected cunning techniques of sanctions evasion through both local and foreign subsidiaries, which operated on a clandestine trade network. From 1968 until 1970, there was virtually no further dialogue between Rhodesia and the UK. In a referendum in 1969, white voters approved a new constitution and the establishment of a republic, thereby severing Rhodesia's last links with the British Crown, duly declared in March 1970. This changed immediately after the election of Edward Heath, who reopened negotiations. Smith remained optimistic that Heath would do his utmost to remedy Anglo-Rhodesian relations, although disappointed that he continued to adhere publicly to the original "five principles" proposed by Alec Douglas-Home, now foreign secretary.
Actin, gamma-enteric smooth muscle is a protein that in humans is encoded by the ACTG2 gene. Actins are highly conserved proteins that are involved in various types of cell motility, and maintenance of the cytoskeleton. In vertebrates, three main groups of actin isoforms, alpha, beta and gamma have been identified. The alpha actins are found in muscle tissues and are a major constituent of the contractile apparatus. The beta and gamma actins co-exist in most cell types as components of the cytoskeleton, and as mediators of internal cell motility. Actin, gamma 2, encoded by this gene, is a smooth muscle actin found in enteric tissues.
Sources: en.wikipedia.org
Semax is a synthetic seven-amino-acid peptide derived from a fragment of corticotropin. It is used in Russia as a nasal preparation, while elsewhere it is studied as a research compound. It is not approved as a medicine in most countries.
Its sequence corresponds to the 4-10 region of corticotropin extended by three residues. This fragment lacks the region responsible for adrenal steroid release, so it is explored for neural rather than hormonal effects. The relationship explains the compound's classification among ACTH-derived peptides.
It holds approval in Russia for several neurological indications as a nasal spray or drop formulation. Regulatory agencies in the United States and the European Union have not approved it. Products sold elsewhere are generally labeled for research use only.
The main proposal is modulation of neurotrophic factors such as brain-derived neurotrophic factor, supported largely by animal experiments. Receptor-level targets have not been firmly established. Most reviews describe the mechanism as only partially characterized.